PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN543524.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 321aa    MW: 34915.8 Da    PI: 7.0181
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN543524.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.41.4e-107131449374
               GRAS  49 Laarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                        ++arl++s+ +ly+ l +ps++  + + +++aa+++f+ +sP++kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gp
  KN543524.1_FGP001   1 MSARLVSSCLGLYAPLpSPSPAGARVHGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGP 92 
                        5799************55555555558899999*********************************************************** PP

               GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklv 231
                        p++R+Tg+g+    s e+le+tg+rL++fA++lg+pfef + va++  +l++e+L v ++Ea+aV++    h+l+d ++s ++    +L+l+
  KN543524.1_FGP001  93 PRVRLTGLGA----SMEALEATGKRLSDFADTLGLPFEFCP-VADKAGNLDPEKLGVTRREAVAVHWLR--HSLYDVTGSDSN----TLWLI 173
                        **********....***************************.7************************99..999999999999....***** PP

               GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                        ++l Pkvv++veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++G
  KN543524.1_FGP001 174 QRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSG 263
                        *****************.899****************************************************999987.************ PP

               GRAS 324 FkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        F+  +l  +aa+qa lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  KN543524.1_FGP001 264 FRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWR 314
                        **************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.1321294IPR005202Transcription factor GRAS
PfamPF035144.8E-1051314IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSARLVSSCL GLYAPLPSPS PAGARVHGRV AAAFQVFNGI SPFVKFSHFT ANQAIQEAFE  60
REERVHIIDL DIMQGLQWPG LFHILASRPG GPPRVRLTGL GASMEALEAT GKRLSDFADT  120
LGLPFEFCPV ADKAGNLDPE KLGVTRREAV AVHWLRHSLY DVTGSDSNTL WLIQRLAPKV  180
VTMVEQDLSH SGSFLARFVE AIHYYSALFD SLDASYSEDS PERHVVEQQL LSREIRNVLA  240
VGGPARTGDV KFGSWREKLA QSGFRVSSLA GSAAAQAALL LGMFPSDGYT LIEENGALKL  300
GWKDLCLLTA SAWRPIQASG R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-501731463375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2431310.0AK243131.1 Oryza sativa Japonica Group cDNA, clone: J100030A12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620600.10.0PREDICTED: protein SCARECROW 2
SwissprotA2ZHL00.0SCR2_ORYSI; Protein SCARECROW 2
SwissprotQ2QYF30.0SCR2_ORYSJ; Protein SCARECROW 2
TrEMBLA0A0D3HQT40.0A0A0D3HQT4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0BEQ60.0A0A0E0BEQ6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0RD240.0A0A0E0RD24_ORYRU; Uncharacterized protein
STRINGBGIOSGA036912-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g02870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-172GRAS family protein